Lineage for d1pvob1 (1pvo B:51-126)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559685Superfamily b.40.4: Nucleic acid-binding proteins [50249] (13 families) (S)
  5. 559965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins)
    barrel, closed; n=5, S=8
  6. 560063Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 560064Species Escherichia coli [TaxId:562] [68911] (8 PDB entries)
  8. 560078Domain d1pvob1: 1pvo B:51-126 [88319]
    Other proteins in same PDB: d1pvoa1, d1pvoa3, d1pvob2, d1pvoc1, d1pvoc3, d1pvod1, d1pvod3, d1pvoe1, d1pvoe3, d1pvof1, d1pvof3

Details for d1pvob1

PDB Entry: 1pvo (more details), 3 Å

PDB Description: x-ray crystal structure of rho transcription termination factor in complex with ssrna substrate and anppnp
PDB Compounds: (B:)

SCOP Domain Sequences for d1pvob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvob1 b.40.4.5 (B:51-126) Rho termination factor, RNA-binding domain {Escherichia coli}
gdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegery
fallkvnevnfdkpen

SCOP Domain Coordinates for d1pvob1:

Click to download the PDB-style file with coordinates for d1pvob1.
(The format of our PDB-style files is described here.)

Timeline for d1pvob1: