SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1pvob1 (1pvo B:51-126)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2051128Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2051511Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 protein domains)
    barrel, closed; n=5, S=8
  6. 2051727Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 2051728Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 2051742Domain d1pvob1: 1pvo B:51-126 [88319]
    Other proteins in same PDB: d1pvoa1, d1pvoa3, d1pvob2, d1pvoc1, d1pvoc3, d1pvod1, d1pvod3, d1pvoe1, d1pvoe3, d1pvof1, d1pvof3
    protein/RNA complex; complexed with anp

Details for d1pvob1

PDB Entry: 1pvo (more details), 3 Å

PDB Description: X-ray crystal structure of Rho transcription termination factor in complex with ssRNA substrate and ANPPNP
PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d1pvob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pvob1 b.40.4.5 (B:51-126) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
gdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkegery
fallkvnevnfdkpen

SCOPe Domain Coordinates for d1pvob1:

Click to download the PDB-style file with coordinates for d1pvob1.
(The format of our PDB-style files is described here.)

Timeline for d1pvob1: