SCOP 1.67: Domain d1pvnd1: 1pvn D:2-99,D:231-494

Lineage for d1pvnd1 (1pvn D:2-99,D:231-494)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (1 family)
   The phosphate moiety of substrate binds in the 'common' phosphate-binding site

5. Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)

6. Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (6 species)

7. Species Tritrichomonas foetus [TaxId:5724] [51417] (9 PDB entries)

8. Domain d1pvnd1: 1pvn D:2-99,D:231-494 [88315]
   there are two CBS domains in the disordered region 100-230
   complexed with k, mzp, trs

Details for d1pvnd1

PDB Entry: 1pvn, 2 Å

PDB Description: the crystal structure of the complex between imp dehydrogenase catalytic domain and a transition state analogue mzp

SCOP Domain Sequences for d1pvnd1:

Sequence; same for both SEQRES and ATOM records:

>d1pvnd1 c.1.5.1 (D:2-99,D:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv
eagadvlcidssdgfsewqkitigwirekygdkvkvgagnivdgegfryladagadfiki
gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal
amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee
gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv
ivk

Timeline for d1pvnd1:

• d1pvnd1 first appeared in SCOP 1.65
  
• d1pvnd1 appears in SCOP 1.69
  
• d1pvnd1 appears in the current release, SCOPe 2.08