Lineage for d1pv4f1 (1pv4 F:1-47)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016973Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2017016Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 2017017Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
    automatically mapped to Pfam PF07498
  6. 2017018Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 2017019Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 2017047Domain d1pv4f1: 1pv4 F:1-47 [88309]
    Other proteins in same PDB: d1pv4a2, d1pv4a3, d1pv4b1, d1pv4b2, d1pv4c2, d1pv4c3, d1pv4d2, d1pv4d3, d1pv4e2, d1pv4e3, d1pv4f2, d1pv4f3
    protein/DNA complex

Details for d1pv4f1

PDB Entry: 1pv4 (more details), 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna
PDB Compounds: (F:) transcription termination factor rho

SCOPe Domain Sequences for d1pv4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv4f1 a.140.3.1 (F:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
mnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1pv4f1:

Click to download the PDB-style file with coordinates for d1pv4f1.
(The format of our PDB-style files is described here.)

Timeline for d1pv4f1: