SCOPe 2.03: Domain d1pv4b2: 1pv4 B:129-417

Lineage for d1pv4b2 (1pv4 B:129-417)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (18 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Transcription termination factor Rho, ATPase domain [89676] (1 species)

7. Species Escherichia coli [TaxId:562] [89677] (5 PDB entries)
   Uniprot P03002

8. Domain d1pv4b2: 1pv4 B:129-417 [88299]
   Other proteins in same PDB: d1pv4a1, d1pv4a2, d1pv4b1, d1pv4c1, d1pv4c2, d1pv4d1, d1pv4d2, d1pv4e1, d1pv4e2, d1pv4f1, d1pv4f2
   protein/DNA complex

Details for d1pv4b2

PDB Entry: 1pv4, 3 Å

PDB Description: x-ray crystal structure of the rho transcription termination factor in complex with single stranded dna

PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d1pv4b2:

Sequence, based on SEQRES records:

>d1pv4b2 c.37.1.11 (B:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmergngstedltarvldlaspigrgqrglivappkagktmll
qniaqsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemvie
kakrlvehkkdviilldsitrlarayntvvpasgkvltggvdanalhrpkrffgaarnve
eggsltiiatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrke
ellttqeelqkmwilrkiihpmgeidameflinklamtktnddffemmk

Sequence, based on observed residues (ATOM records):

>d1pv4b2 c.37.1.11 (B:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}
nkilfenltplhansrlrmgstedltarvldlaspigrgqrglivappkagktmllqnia
qsiaynhpdcvlmvlliderpeevtemqrlvkgevvastfdepasrhvqvaemviekakr
lvehkkdviilldsitrlarayntvvpavltggvdanalhrpkrffgaarnveeggslti
iatalidtgskmdeviyeefkgtgnmelhlsrkiaekrvfpaidynrsgtrkeellttqe
elqkmwilrkiihpmgeidameflinklamtktnddffemmk

Timeline for d1pv4b2:

• d1pv4b2 first appeared in SCOP 1.65
  
• d1pv4b2 appears in SCOPe 2.02
  
• d1pv4b2 appears in SCOPe 2.04
  
• d1pv4b2 appears in the current release, SCOPe 2.08