Lineage for d1puja_ (1puj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110612Protein Probable GTPase YlqF [89669] (1 species)
    naturally occurring circular permutation of G-domain; includes C-terminal all-alpha subdomain
  7. 2110613Species Bacillus subtilis [TaxId:1423] [89670] (1 PDB entry)
  8. 2110614Domain d1puja_: 1puj A: [88294]
    structural genomics
    complexed with gnp, mg

Details for d1puja_

PDB Entry: 1puj (more details), 2 Å

PDB Description: Structure of B. subtilis YlqF GTPase
PDB Compounds: (A:) conserved hypothetical protein ylqF

SCOPe Domain Sequences for d1puja_:

Sequence, based on SEQRES records: (download)

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}
hmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavt
qqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigi
pnvgkstlinrlakkniaktgdrpgittsqqwvkvgkelelldtpgilwpkfedelvglr
lavtgaikdsiinlqdvavfglrfleehyperlkerygldeipediaelfdaigekrgcl
msgglinydktteviirdirtekfgrlsfeqpt

Sequence, based on observed residues (ATOM records): (download)

>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]}
hmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavt
qqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigi
pnvgkstlinrlakkniaqwvkvgkelelldtpgilwpkfedelvglrlavtgaikdsii
nlqdvavfglrfleehyperlkerygldeipediaelfdaigekrgclmsgglinydktt
eviirdirtekfgrlsfeqpt

SCOPe Domain Coordinates for d1puja_:

Click to download the PDB-style file with coordinates for d1puja_.
(The format of our PDB-style files is described here.)

Timeline for d1puja_: