![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Probable GTPase YlqF [89669] (1 species) naturally occurring circular permutation of G-domain; includes C-terminal all-alpha subdomain |
![]() | Species Bacillus subtilis [TaxId:1423] [89670] (1 PDB entry) |
![]() | Domain d1puja_: 1puj A: [88294] structural genomics complexed with gnp, mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 1puj (more details), 2 Å
SCOPe Domain Sequences for d1puja_:
Sequence, based on SEQRES records: (download)
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} hmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavt qqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigi pnvgkstlinrlakkniaktgdrpgittsqqwvkvgkelelldtpgilwpkfedelvglr lavtgaikdsiinlqdvavfglrfleehyperlkerygldeipediaelfdaigekrgcl msgglinydktteviirdirtekfgrlsfeqpt
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} hmakarrevteklklidivyelvdaripmssrnpmiedilknkprimllnkadkadaavt qqwkehfenqgirslsinsvngqglnqivpaskeilqekfdrmrakgvkprairaliigi pnvgkstlinrlakkniaqwvkvgkelelldtpgilwpkfedelvglrlavtgaikdsii nlqdvavfglrfleehyperlkerygldeipediaelfdaigekrgclmsgglinydktt eviirdirtekfgrlsfeqpt
Timeline for d1puja_: