Lineage for d1pswa_ (1psw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142428Family c.87.1.7: ADP-heptose LPS heptosyltransferase II [89784] (1 protein)
  6. 2142429Protein ADP-heptose LPS heptosyltransferase II [89785] (1 species)
  7. 2142430Species Escherichia coli [TaxId:562] [89786] (1 PDB entry)
  8. 2142431Domain d1pswa_: 1psw A: [88287]
    structural genomics

Details for d1pswa_

PDB Entry: 1psw (more details), 2 Å

PDB Description: Structure of E. coli ADP-heptose lps heptosyltransferase II
PDB Compounds: (A:) ADP-heptose lps heptosyltransferase II

SCOPe Domain Sequences for d1pswa_:

Sequence, based on SEQRES records: (download)

>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]}
mkilvigpswvgdmmmsqslyrtlqarypqaiidvmapawcrpllsrmpevneaipmplg
hgaleigerrklghslrekrydrayvlpnsfksalvplfagiphrtgwrgemrygllndv
rvldkeawplmveryialaydkgimrtaqdlpqpllwpqlqvsegeksytcnqfslsser
pmigfcpgaefgpakrwphyhyaelakqlidegyqvvlfgsakdheagneilaalnteqq
awcrnlagetqldqaviliaackaivtndsglmhvaaalnrplvalygpsspdftpplsh
karvirlitgyhkvrkgdaaegyhqsliditpqrvleelnalllqeea

Sequence, based on observed residues (ATOM records): (download)

>d1pswa_ c.87.1.7 (A:) ADP-heptose LPS heptosyltransferase II {Escherichia coli [TaxId: 562]}
mkilvigpswvgdmmmsqslyrtlqarypqaiidvmapawcrpllsrmpevneaipmeig
errklghslrekrydrayvlpnsfksalvplfagiphrtgwrgemrygllndvrvldkea
wplmveryialaydkgimrtaqdlpqpllwpqlqvsegeksytcnqfslsserpmigfcp
gaefgpakrwphyhyaelakqlidegyqvvlfgsakdheagneilaalnteqqawcrnla
getqldqaviliaackaivtndsglmhvaaalnrplvalygpsspdftpplshkarvirl
itgegyhqsliditpqrvleelnalllqeea

SCOPe Domain Coordinates for d1pswa_:

Click to download the PDB-style file with coordinates for d1pswa_.
(The format of our PDB-style files is described here.)

Timeline for d1pswa_: