Lineage for d1psua_ (1psu A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601788Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 601789Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 601873Family d.38.1.5: PaaI/YdiI-like [89902] (8 proteins)
  6. 601915Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 601916Species Escherichia coli [TaxId:562] [89904] (1 PDB entry)
  8. 601917Domain d1psua_: 1psu A: [88285]

Details for d1psua_

PDB Entry: 1psu (more details), 2.2 Å

PDB Description: structure of the e. coli paai protein from the phyenylacetic acid degradation operon

SCOP Domain Sequences for d1psua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psua_ d.38.1.5 (A:) Phenylacetic acid degradation protein PaaI {Escherichia coli}
mshkawqnahamyendacakalgidiismdegfavvtmtvtaqmlnghqschggqlfsla
dtafayacnsqglaavasactidflrpgfagdtltataqvrhqgkqtgvydieivnqqqk
tvalfrgkshr

SCOP Domain Coordinates for d1psua_:

Click to download the PDB-style file with coordinates for d1psua_.
(The format of our PDB-style files is described here.)

Timeline for d1psua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1psub_