Lineage for d1psqb_ (1psq B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2456544Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2456792Protein Probable thiol peroxidase PsaD [89710] (1 species)
  7. 2456793Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89711] (1 PDB entry)
  8. 2456795Domain d1psqb_: 1psq B: [88284]
    structural genomics

Details for d1psqb_

PDB Entry: 1psq (more details), 2.3 Å

PDB Description: Structure of a probable thiol peroxidase from Streptococcus pneumoniae
PDB Compounds: (B:) Probable thiol peroxidase

SCOPe Domain Sequences for d1psqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psqb_ c.47.1.10 (B:) Probable thiol peroxidase PsaD {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicst
qtrrfneelagldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallin
ewhllaravfvldtdntiryveyvdninsepnfeaaiaaakal

SCOPe Domain Coordinates for d1psqb_:

Click to download the PDB-style file with coordinates for d1psqb_.
(The format of our PDB-style files is described here.)

Timeline for d1psqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1psqa_