SCOPe 2.05: Domain d1psqa_: 1psq A:

Lineage for d1psqa_ (1psq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Probable thiol peroxidase PsaD [89710] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [89711] (1 PDB entry)

8. Domain d1psqa_: 1psq A: [88283]
   structural genomics

Details for d1psqa_

PDB Entry: 1psq, 2.3 Å

PDB Description: structure of a probable thiol peroxidase from streptococcus pneumoniae

PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d1psqa_:

Sequence; same for both SEQRES and ATOM records:

>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvtflgnpvsftgkqlqvgdkaldfsltttdlskksladfdgkkkvlsvvpsidtgicst
qtrrfneelagldntvvltvsmdlpfaqkrwcgaegldnaimlsdyfdhsfgrdyallin
ewhllaravfvldtdntiryveyvdninsepnfeaaiaaakal

Timeline for d1psqa_:

• d1psqa_ first appeared in SCOP 1.65
  
• d1psqa_ appears in SCOPe 2.04
  
• d1psqa_ appears in SCOPe 2.06
  
• d1psqa_ appears in the current release, SCOPe 2.08