Lineage for d1pr7a_ (1pr7 A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 562942Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 562943Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 563392Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 563471Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 563477Species Human (Homo sapiens) [TaxId:9606] [50669] (9 PDB entries)
  8. 563489Domain d1pr7a_: 1pr7 A: [88280]

Details for d1pr7a_

PDB Entry: 1pr7 (more details), 3.65 Å

PDB Description: renin complexed with compound ib

SCOP Domain Sequences for d1pr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pr7a_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens)}
nttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklf
dasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaef
dgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpq
hyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklme
algakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamd
ippptgptwalgatfirkfytefdrrnnrigfalar

SCOP Domain Coordinates for d1pr7a_:

Click to download the PDB-style file with coordinates for d1pr7a_.
(The format of our PDB-style files is described here.)

Timeline for d1pr7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pr7b_