![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
![]() | Protein Putative enoyl reductase domain of polyketide synthase [89515] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [89516] (1 PDB entry) |
![]() | Domain d1pqwa_: 1pqw A: [88278] |
PDB Entry: 1pqw (more details), 2.66 Å
SCOP Domain Sequences for d1pqwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis} neaatfgvayltawhslcevgrlspgervlihsatggvgmaavsiakmigariyttagsd akremlsrlgveyvgdsrsvdfadeileltdgygvdvvlnslageaiqrgvqilapggrf ielgkkdvyadaslglaalaksasfsvvdldlnlklqparyrqllqhilqhvadgklevl pvt
Timeline for d1pqwa_: