Lineage for d1pqsa_ (1pqs A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499486Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 499697Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) (S)
    contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily
  5. 499713Family d.15.2.2: PB1 domain [64225] (5 proteins)
    Pfam 00564
    forms heterodimers, although not all PB1 domain pairs associate.
  6. 499718Protein Cell division control protein 24, CDC24, C-terminal domain [89834] (1 species)
  7. 499719Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89835] (2 PDB entries)
  8. 499720Domain d1pqsa_: 1pqs A: [88277]
    cloning artifact: lacks the N-terminal strand of the common fold and has a rearranged beta-sheet

Details for d1pqsa_

PDB Entry: 1pqs (more details)

PDB Description: solution structure of the c-terminal opca domain of ycdc24p

SCOP Domain Sequences for d1pqsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pqsa_ d.15.2.2 (A:) Cell division control protein 24, CDC24, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
seiftllvekvwnfddlimainskisnthnnnispitkikyqdedgdfvvlgsdedwnva
kemlaennekflnirly

SCOP Domain Coordinates for d1pqsa_:

Click to download the PDB-style file with coordinates for d1pqsa_.
(The format of our PDB-style files is described here.)

Timeline for d1pqsa_: