Lineage for d1pnys_ (1pny S:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268606Domain d1pnys_: 1pny S: [88269]
    Other proteins in same PDB: d1pny52
    50S subunit; the coordinates of 30S subunit in 1pnx
    protein/RNA complex
    protein/RNA complex

Details for d1pnys_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.
PDB Compounds: (S:) 50S ribosomal protein L24

SCOPe Domain Sequences for d1pnys_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnys_ i.1.1.1 (S:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti

SCOPe Domain Coordinates for d1pnys_:

Click to download the PDB-style file with coordinates for d1pnys_.
(The format of our PDB-style files is described here.)

Timeline for d1pnys_: