SCOP 1.73: Domain d1pnym_: 1pny M:

Lineage for d1pnym_ (1pny M:)

1. Root: SCOP 1.73

2. Class i: Low resolution protein structures [58117] (26 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)

8. Domain d1pnym_: 1pny M: [88263]

Details for d1pnym_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

PDB Compounds: (M:) 50S ribosomal protein L18

SCOP Domain Sequences for d1pnym_:

Sequence; same for both SEQRES and ATOM records:

>d1pnym_ i.1.1.1 (M:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf

Timeline for d1pnym_:

• d1pnym_ first appeared in SCOP 1.65
  
• d1pnym_ appears in SCOP 1.71
  
• d1pnym_ appears in SCOP 1.75
  
• d1pnym_ appears in the current release, SCOPe 2.08