SCOPe 2.03: Domain d1pnyl_: 1pny L:

Lineage for d1pnyl_ (1pny L:)

1. Root: SCOPe 2.03

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnyl_: 1pny L: [88262]
   50S subunit; the coordinates of 30S subunit in 1pnx
   protein/RNA complex

Details for d1pnyl_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

PDB Compounds: (L:) 50S ribosomal protein L17

SCOPe Domain Sequences for d1pnyl_:

Sequence; same for both SEQRES and ATOM records:

>d1pnyl_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv

Timeline for d1pnyl_:

• d1pnyl_ first appeared in SCOP 1.65
  
• d1pnyl_ appears in SCOPe 2.02
  
• d1pnyl_ appears in SCOPe 2.04
  
• d1pnyl_ appears in the current release, SCOPe 2.08