SCOPe 2.05: Domain d1pnyk_: 1pny K:

Lineage for d1pnyk_ (1pny K:)

1. Root: SCOPe 2.05

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnyk_: 1pny K: [88261]
   50S subunit; the coordinates of 30S subunit in 1pnx
   protein/RNA complex
   protein/RNA complex

Details for d1pnyk_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

PDB Compounds: (K:) 50S ribosomal protein L16

SCOPe Domain Sequences for d1pnyk_:

Sequence; same for both SEQRES and ATOM records:

>d1pnyk_ i.1.1.1 (K:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
iqtk

Timeline for d1pnyk_:

• d1pnyk_ first appeared in SCOP 1.65
  
• d1pnyk_ appears in SCOPe 2.04
  
• d1pnyk_ appears in SCOPe 2.06
  
• d1pnyk_ appears in the current release, SCOPe 2.07