Lineage for d1pnyi_ (1pny I:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710704Domain d1pnyi_: 1pny I: [88259]
    50S subunit; the coordinates of 30S subunit in 1pnx
    protein/RNA complex

Details for d1pnyi_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.
PDB Compounds: (I:) 50S ribosomal protein L14

SCOPe Domain Sequences for d1pnyi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnyi_ i.1.1.1 (I:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
rfmkivslapev

SCOPe Domain Coordinates for d1pnyi_:

Click to download the PDB-style file with coordinates for d1pnyi_.
(The format of our PDB-style files is described here.)

Timeline for d1pnyi_: