Lineage for d1pnyh_ (1pny H:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 753844Domain d1pnyh_: 1pny H: [88258]

Details for d1pnyh_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.
PDB Compounds: (H:) 50S ribosomal protein L13

SCOP Domain Sequences for d1pnyh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnyh_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
kvyagethphsaqkpqvlktqpl

SCOP Domain Coordinates for d1pnyh_:

Click to download the PDB-style file with coordinates for d1pnyh_.
(The format of our PDB-style files is described here.)

Timeline for d1pnyh_: