SCOPe 2.08: Domain d1pnyh_: 1pny H:

Lineage for d1pnyh_ (1pny H:)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnyh_: 1pny H: [88258]
   Other proteins in same PDB: d1pny52
   50S subunit; the coordinates of 30S subunit in 1pnx
   protein/RNA complex
   protein/RNA complex

Details for d1pnyh_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

PDB Compounds: (H:) 50S ribosomal protein L13

SCOPe Domain Sequences for d1pnyh_:

Sequence; same for both SEQRES and ATOM records:

>d1pnyh_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
kvyagethphsaqkpqvlktqpl

Timeline for d1pnyh_:

• d1pnyh_ first appeared in SCOP 1.65
  
• d1pnyh_ appears in SCOPe 2.07