Lineage for d1pnyf_ (1pny F:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 345890Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)
  8. 345987Domain d1pnyf_: 1pny F: [88256]

Details for d1pnyf_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

SCOP Domain Sequences for d1pnyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnyf_ i.1.1.1 (F:) 70S ribosome functional complex {Escherichia coli}
mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs

SCOP Domain Coordinates for d1pnyf_:

Click to download the PDB-style file with coordinates for d1pnyf_.
(The format of our PDB-style files is described here.)

Timeline for d1pnyf_: