SCOP 1.69: Domain d1pnyb_: 1pny B:

Lineage for d1pnyb_ (1pny B:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)

8. Domain d1pnyb_: 1pny B: [88252]

Details for d1pnyb_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

SCOP Domain Sequences for d1pnyb_:

Sequence; same for both SEQRES and ATOM records:

>d1pnyb_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli}
mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
lilvkgaipgangglvvlrsaakas

Timeline for d1pnyb_:

• d1pnyb_ first appeared in SCOP 1.65
  
• d1pnyb_ appears in SCOP 1.67
  
• d1pnyb_ appears in SCOP 1.71
  
• d1pnyb_ appears in the current release, SCOPe 2.08