SCOP 1.67: Domain d1pny2_: 1pny 2:

Lineage for d1pny2_ (1pny 2:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)

8. Domain d1pny2_: 1pny 2: [88246]

Details for d1pny2_

PDB Entry: 1pny, 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.

SCOP Domain Sequences for d1pny2_:

Sequence; same for both SEQRES and ATOM records:

>d1pny2_ i.1.1.1 (2:) 70S ribosome functional complex {Escherichia coli}
mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd

Timeline for d1pny2_:

• d1pny2_ first appeared in SCOP 1.65
  
• d1pny2_ appears in SCOP 1.69
  
• d1pny2_ appears in the current release, SCOPe 2.08