Lineage for d1pny1_ (1pny 1:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896762Domain d1pny1_: 1pny 1: [88245]
    50S subunit; the coordinates of 30S subunit in 1pnx

Details for d1pny1_

PDB Entry: 1pny (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 50s subunit of 70s ribosome. this file, 1pny, contains only molecules of the 50s ribosomal subunit. the 30s subunit is in the pdb file 1pnx.
PDB Compounds: (1:) 50S ribosomal protein L33

SCOP Domain Sequences for d1pny1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pny1_ i.1.1.1 (1:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOP Domain Coordinates for d1pny1_:

Click to download the PDB-style file with coordinates for d1pny1_.
(The format of our PDB-style files is described here.)

Timeline for d1pny1_: