Lineage for d1pnxr_ (1pnx R:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526424Domain d1pnxr_: 1pnx R: [88241]

Details for d1pnxr_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.

SCOP Domain Sequences for d1pnxr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxr_ i.1.1.1 (R:) 70S ribosome functional complex {Escherichia coli}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1pnxr_:

Click to download the PDB-style file with coordinates for d1pnxr_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxr_: