Lineage for d1pnxp_ (1pnx P:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627145Domain d1pnxp_: 1pnx P: [88239]

Details for d1pnxp_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.

SCOP Domain Sequences for d1pnxp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxp_ i.1.1.1 (P:) 70S ribosome functional complex {Escherichia coli}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1pnxp_:

Click to download the PDB-style file with coordinates for d1pnxp_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxp_: