Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1pnxo_: 1pnx O: [88238] 30S subunit; the coordinates of 50S subunit in 1pny protein/RNA complex protein/RNA complex |
PDB Entry: 1pnx (more details), 9.5 Å
SCOPe Domain Sequences for d1pnxo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnxo_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1pnxo_: