Lineage for d1pnxi_ (1pnx I:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 345890Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)
  8. 345963Domain d1pnxi_: 1pnx I: [88232]

Details for d1pnxi_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.
PDB Compounds: (I:)

SCOP Domain Sequences for d1pnxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxi_ i.1.1.1 (I:) 70S ribosome functional complex {Escherichia coli}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1pnxi_:

Click to download the PDB-style file with coordinates for d1pnxi_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxi_: