Lineage for d1pnxh_ (1pnx H:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432188Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)
  8. 432228Domain d1pnxh_: 1pnx H: [88231]

Details for d1pnxh_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.

SCOP Domain Sequences for d1pnxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxh_ i.1.1.1 (H:) 70S ribosome functional complex {Escherichia coli}
mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
drearklgvggelicevw

SCOP Domain Coordinates for d1pnxh_:

Click to download the PDB-style file with coordinates for d1pnxh_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxh_: