Lineage for d1pnxe_ (1pnx E:)

  1. Root: SCOPe 2.05
  2. 1970697Class i: Low resolution protein structures [58117] (25 folds)
  3. 1970698Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1970699Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1970700Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 1970701Protein 70S ribosome functional complex [58121] (4 species)
  7. 1970702Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1970919Domain d1pnxe_: 1pnx E: [88228]
    30S subunit; the coordinates of 50S subunit in 1pny
    protein/RNA complex
    protein/RNA complex

Details for d1pnxe_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d1pnxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxe_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOPe Domain Coordinates for d1pnxe_:

Click to download the PDB-style file with coordinates for d1pnxe_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxe_: