Lineage for d1pnxe_ (1pnx E:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896613Domain d1pnxe_: 1pnx E: [88228]
    30S subunit; the coordinates of 50S subunit in 1pny

Details for d1pnxe_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d1pnxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxe_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1pnxe_:

Click to download the PDB-style file with coordinates for d1pnxe_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxe_: