Lineage for d1pnxc_ (1pnx C:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1248493Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1248708Domain d1pnxc_: 1pnx C: [88226]
    30S subunit; the coordinates of 50S subunit in 1pny
    protein/RNA complex

Details for d1pnxc_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d1pnxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d1pnxc_:

Click to download the PDB-style file with coordinates for d1pnxc_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxc_: