Lineage for d1pnxb_ (1pnx B:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042741Domain d1pnxb_: 1pnx B: [88225]
    30S subunit; the coordinates of 50S subunit in 1pny
    protein/RNA complex
    protein/RNA complex

Details for d1pnxb_

PDB Entry: 1pnx (more details), 9.5 Å

PDB Description: crystal structure of the wild type ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pnx, contains only molecules of the 30s ribosomal subunit. the 50s subunit is in the pdb file 1pny.
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d1pnxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnxb_ i.1.1.1 (B:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d1pnxb_:

Click to download the PDB-style file with coordinates for d1pnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1pnxb_: