Lineage for d1pnuy_ (1pnu Y:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268581Domain d1pnuy_: 1pnu Y: [88222]
    Other proteins in same PDB: d1pnu52
    50S subunit; the coordinates of 30S subunit in 1pns
    protein/RNA complex
    protein/RNA complex

Details for d1pnuy_

PDB Entry: 1pnu (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.
PDB Compounds: (Y:) 50S ribosomal protein L31

SCOPe Domain Sequences for d1pnuy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnuy_ i.1.1.1 (Y:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
krfgdsyrrgskk

SCOPe Domain Coordinates for d1pnuy_:

Click to download the PDB-style file with coordinates for d1pnuy_.
(The format of our PDB-style files is described here.)

Timeline for d1pnuy_: