SCOPe 2.06: Domain d1pnut_: 1pnu T:

Lineage for d1pnut_ (1pnu T:)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (3 proteins)

6. Protein 70S ribosome functional complex [58121] (4 species)

7. Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)

8. Domain d1pnut_: 1pnu T: [88217]
   Other proteins in same PDB: d1pnu52
   50S subunit; the coordinates of 30S subunit in 1pns
   protein/RNA complex
   protein/RNA complex

Details for d1pnut_

PDB Entry: 1pnu, 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.

PDB Compounds: (T:) general stress protein ctc

SCOPe Domain Sequences for d1pnut_:

Sequence; same for both SEQRES and ATOM records:

>d1pnut_ i.1.1.1 (T:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlp

Timeline for d1pnut_:

• d1pnut_ first appeared in SCOP 1.65
  
• d1pnut_ appears in SCOPe 2.05
  
• d1pnut_ appears in SCOPe 2.07
  
• d1pnut_ appears in the current release, SCOPe 2.08