SCOP 1.69: Domain d1pnuj_: 1pnu J:

Lineage for d1pnuj_ (1pnu J:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)

8. Domain d1pnuj_: 1pnu J: [88207]

Details for d1pnuj_

PDB Entry: 1pnu, 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.

SCOP Domain Sequences for d1pnuj_:

Sequence; same for both SEQRES and ATOM records:

>d1pnuj_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

Timeline for d1pnuj_:

• d1pnuj_ first appeared in SCOP 1.65
  
• d1pnuj_ appears in SCOP 1.67
  
• d1pnuj_ appears in SCOP 1.71
  
• d1pnuj_ appears in the current release, SCOPe 2.08