Lineage for d1pnuj_ (1pnu J:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 345890Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)
  8. 345938Domain d1pnuj_: 1pnu J: [88207]

Details for d1pnuj_

PDB Entry: 1pnu (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.

SCOP Domain Sequences for d1pnuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnuj_ i.1.1.1 (J:) 70S ribosome functional complex {Escherichia coli}
hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
aasaaaikaveaaggrvvlpe

SCOP Domain Coordinates for d1pnuj_:

Click to download the PDB-style file with coordinates for d1pnuj_.
(The format of our PDB-style files is described here.)

Timeline for d1pnuj_: