Lineage for d1pnuc_ (1pnu C:)

  1. Root: SCOP 1.75
  2. 896322Class i: Low resolution protein structures [58117] (26 folds)
  3. 896323Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 896324Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 896325Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 896326Protein 70S ribosome functional complex [58121] (9 species)
  7. 896398Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 896638Domain d1pnuc_: 1pnu C: [88200]
    50S subunit; the coordinates of 30S subunit in 1pns

Details for d1pnuc_

PDB Entry: 1pnu (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.
PDB Compounds: (C:) 50S ribosomal protein L4

SCOP Domain Sequences for d1pnuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnuc_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOP Domain Coordinates for d1pnuc_:

Click to download the PDB-style file with coordinates for d1pnuc_.
(The format of our PDB-style files is described here.)

Timeline for d1pnuc_: