Lineage for d1pnu3_ (1pnu 3:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 753803Domain d1pnu3_: 1pnu 3: [88194]

Details for d1pnu3_

PDB Entry: 1pnu (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.
PDB Compounds: (3:) 50S ribosomal protein L35

SCOP Domain Sequences for d1pnu3_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnu3_ i.1.1.1 (3:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOP Domain Coordinates for d1pnu3_:

Click to download the PDB-style file with coordinates for d1pnu3_.
(The format of our PDB-style files is described here.)

Timeline for d1pnu3_: