Lineage for d1pnu1_ (1pnu 1:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 432184Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 432185Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 432186Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 432187Protein 70S ribosome functional complex [58121] (2 species)
  7. 432188Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)
  8. 432242Domain d1pnu1_: 1pnu 1: [88192]

Details for d1pnu1_

PDB Entry: 1pnu (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. this file, 1pnu, contains only molecules of the 50s ribosomal subunit. the 30s subunit, mrna, p-site trna, and a-site trna are in the pdb file 1pns.

SCOP Domain Sequences for d1pnu1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnu1_ i.1.1.1 (1:) 70S ribosome functional complex {Escherichia coli}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOP Domain Coordinates for d1pnu1_:

Click to download the PDB-style file with coordinates for d1pnu1_.
(The format of our PDB-style files is described here.)

Timeline for d1pnu1_: