Lineage for d1pnso_ (1pns O:)

  1. Root: SCOP 1.73
  2. 753709Class i: Low resolution protein structures [58117] (26 folds)
  3. 753710Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 753711Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 753712Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 753713Protein 70S ribosome functional complex [58121] (3 species)
  7. 753759Species Escherichia coli [TaxId:562] [58123] (34 PDB entries)
  8. 753776Domain d1pnso_: 1pns O: [88182]

Details for d1pnso_

PDB Entry: 1pns (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d1pnso_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnso_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1pnso_:

Click to download the PDB-style file with coordinates for d1pnso_.
(The format of our PDB-style files is described here.)

Timeline for d1pnso_: