SCOP 1.69: Domain d1pnsn_: 1pns N:

Lineage for d1pnsn_ (1pns N:)

1. Root: SCOP 1.69

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (3 species)

7. Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)

8. Domain d1pnsn_: 1pns N: [88181]

Details for d1pnsn_

PDB Entry: 1pns, 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.

SCOP Domain Sequences for d1pnsn_:

Sequence; same for both SEQRES and ATOM records:

>d1pnsn_ i.1.1.1 (N:) 70S ribosome functional complex {Escherichia coli}
arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw

Timeline for d1pnsn_:

• d1pnsn_ first appeared in SCOP 1.65
  
• d1pnsn_ appears in SCOP 1.67
  
• d1pnsn_ appears in SCOP 1.71
  
• d1pnsn_ appears in the current release, SCOPe 2.08