Lineage for d1pnsi_ (1pns I:)

  1. Root: SCOP 1.69
  2. 526321Class i: Low resolution protein structures [58117] (24 folds)
  3. 526322Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 526323Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 526324Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 526325Protein 70S ribosome functional complex [58121] (3 species)
  7. 526374Species Escherichia coli [TaxId:562] [58123] (29 PDB entries)
  8. 526392Domain d1pnsi_: 1pns I: [88176]

Details for d1pnsi_

PDB Entry: 1pns (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.
PDB Compounds: (I:)

SCOP Domain Sequences for d1pnsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnsi_ i.1.1.1 (I:) 70S ribosome functional complex {Escherichia coli}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1pnsi_:

Click to download the PDB-style file with coordinates for d1pnsi_.
(The format of our PDB-style files is described here.)

Timeline for d1pnsi_: