Lineage for d1pnse_ (1pns E:)

  1. Root: SCOP 1.65
  2. 345885Class i: Low resolution protein structures [58117] (18 folds)
  3. 345886Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 345887Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 345888Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 345889Protein 70S ribosome functional complex [58121] (2 species)
  7. 345890Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)
  8. 345903Domain d1pnse_: 1pns E: [88172]

Details for d1pnse_

PDB Entry: 1pns (more details), 8.7 Å

PDB Description: crystal structure of a streptomycin dependent ribosome from e. coli, 30s subunit of 70s ribosome. this file, 1pns, contains the 30s subunit, two trnas, and one mrna molecule. the 50s ribosomal subunit is in file 1pnu.
PDB Compounds: (E:)

SCOP Domain Sequences for d1pnse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnse_ i.1.1.1 (E:) 70S ribosome functional complex {Escherichia coli}
dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
srnpiniayatmealrqlrtkadverlrkg

SCOP Domain Coordinates for d1pnse_:

Click to download the PDB-style file with coordinates for d1pnse_.
(The format of our PDB-style files is described here.)

Timeline for d1pnse_: