Lineage for d1pn8l_ (1pn8 L:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710494Domain d1pn8l_: 1pn8 L: [88166]
    S12, L11 proteins and E-site tRNA aligned to the cryo-EM map
    protein/RNA complex

Details for d1pn8l_

PDB Entry: 1pn8 (more details), 10.8 Å

PDB Description: coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.
PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1pn8l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn8l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOPe Domain Coordinates for d1pn8l_:

Click to download the PDB-style file with coordinates for d1pn8l_.
(The format of our PDB-style files is described here.)

Timeline for d1pn8l_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pn8o_