Lineage for d1pn8l_ (1pn8 L:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627097Species Escherichia coli [TaxId:562] [58123] (39 PDB entries)
  8. 627457Domain d1pn8l_: 1pn8 L: [88166]

Details for d1pn8l_

PDB Entry: 1pn8 (more details)

PDB Description: coordinates of s12, l11 proteins and e-site trna from 70s crystal structure separately fitted into the cryo-em map of e.coli 70s.ef-g.gdpnp complex. the atomic coordinates originally from the e-site trna were fitted in the position of the hybrid p/e-site trna.

SCOP Domain Sequences for d1pn8l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn8l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOP Domain Coordinates for d1pn8l_:

Click to download the PDB-style file with coordinates for d1pn8l_.
(The format of our PDB-style files is described here.)

Timeline for d1pn8l_: