Lineage for d1pn7o_ (1pn7 O:)

  1. Root: SCOPe 2.07
  2. 2592940Class i: Low resolution protein structures [58117] (25 folds)
  3. 2592941Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2592942Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2592943Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2592944Protein 70S ribosome functional complex [58121] (4 species)
  7. 2592945Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2593011Domain d1pn7o_: 1pn7 O: [88164]
    S12, L11 proteins and p-tRNA aligned to the cryo-EM map
    protein/RNA complex

Details for d1pn7o_

PDB Entry: 1pn7 (more details), 10.8 Å

PDB Description: Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome
PDB Compounds: (O:) 30S ribosomal protein S12

SCOPe Domain Sequences for d1pn7o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn7o_ i.1.1.1 (O:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOPe Domain Coordinates for d1pn7o_:

Click to download the PDB-style file with coordinates for d1pn7o_.
(The format of our PDB-style files is described here.)

Timeline for d1pn7o_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pn7l_