Lineage for d1pn7l_ (1pn7 L:)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2268315Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 2268316Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 2268317Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 2268318Protein 70S ribosome functional complex [58121] (4 species)
  7. 2268319Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 2268384Domain d1pn7l_: 1pn7 L: [88163]
    S12, L11 proteins and p-tRNA aligned to the cryo-EM map
    protein/RNA complex

Details for d1pn7l_

PDB Entry: 1pn7 (more details), 10.8 Å

PDB Description: Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome
PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1pn7l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn7l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOPe Domain Coordinates for d1pn7l_:

Click to download the PDB-style file with coordinates for d1pn7l_.
(The format of our PDB-style files is described here.)

Timeline for d1pn7l_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pn7o_