SCOP 1.65: Domain d1pn7l_: 1pn7 L:

Lineage for d1pn7l_ (1pn7 L:)

1. Root: SCOP 1.65

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (21 PDB entries)

8. Domain d1pn7l_: 1pn7 L: [88163]

Details for d1pn7l_

PDB Entry: 1pn7

PDB Description: Coordinates of S12, L11 proteins and P-tRNA, from the 70S X-ray structure aligned to the 70S Cryo-EM map of E.coli ribosome

SCOP Domain Sequences for d1pn7l_:

Sequence; same for both SEQRES and ATOM records:

>d1pn7l_ i.1.1.1 (L:) 70S ribosome functional complex {Escherichia coli}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

Timeline for d1pn7l_:

• d1pn7l_ is new in SCOP 1.65
  
• d1pn7l_ appears in SCOP 1.67
  
• d1pn7l_ appears in the current release, SCOPe 2.08