Lineage for d1pn6a_ (1pn6 A:)

  1. Root: SCOPe 2.04
  2. 1710350Class i: Low resolution protein structures [58117] (25 folds)
  3. 1710351Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1710352Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1710353Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1710354Protein 70S ribosome functional complex [58121] (9 species)
  7. 1710427Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 1710491Domain d1pn6a_: 1pn6 A: [88161]
    domain-wise fitting of the crystal structure of T. thermophilus EF-G in the cryo-EM map of 70S ribosome

Details for d1pn6a_

PDB Entry: 1pn6 (more details), 10.8 Å

PDB Description: Domain-wise fitting of the crystal structure of T.thermophilus EF-G into the low resolution map of the release complex.Puromycin.EFG.GDPNP of E.coli 70S ribosome.
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d1pn6a_:

Sequence, based on SEQRES records: (download)

>d1pn6a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
eydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergiti
taavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqsetvwrqa
ekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmka
ytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelvaa
irkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevveihpdp
ngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmhanhree
veelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkadqekls
qalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpqvayre
titkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyipavqkg
ieeamqsgpligfpvvdikvtlydgsyaevdssemafkiagsmaikeavqkgdpvilepi
mrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlrsktqg
rgsfvmffdhyqevpkqvqekli

Sequence, based on observed residues (ATOM records): (download)

>d1pn6a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
eydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdftie
versmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirtm
qerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqareyh
eklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqlll
davvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysg
tltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvged
aprvilesievpepvidvaiepktkadqeklsqalarlaeedptfrvsthpetgqtiisg
mgelhleiivdrlkrefkvdanvgkpqvayretitkpvdvegkfirqtggrgqyghvkik
veplprgsgfefvnaivggvipkeyipavqkgieeamqsgpligfpvvdikvtlydgsya
evdssemafkiagsmaikeavqkgdpvilepimrvevttpeeymgdvigdlnarrgqilg
meprgnaqvirafvplaemfgyatdlrsktqgrgsfvmffdhyqevpkqvqekli

SCOPe Domain Coordinates for d1pn6a_:

Click to download the PDB-style file with coordinates for d1pn6a_.
(The format of our PDB-style files is described here.)

Timeline for d1pn6a_: